A broad-spectrum virus- and host-targeting antiviral peptide against SARS-CoV-2 and other respiratory viruses

Zhao, Hanjun; To, Kelvin Kai‐Wang; Sze, Kong-Hung; Yung, Timothy Tin-Mong; Bian, Mingjie; Lam, Hoiyan; Li, Cun; Chu, Hin; Yuen, Kwok‐Yung

doi:10.21203/rs.3.rs-18687/v1

Cited by 5 publications

(4 citation statements)

References 48 publications

Supporting

Mentioning

Contrasting

Order By: Relevance

“…Overall, the outcome of the study was overwhelmingly positive, particularly in light of the fact that numerous pathogenic viruses are endosomal pH-dependent viruses. It is also anticipated that the aforementioned findings might also spur other researchers to embark on similar endeavours in pursuit of generating antivirals that can prevent virus-host endosomal acidification [ 226 ].…”

Section: Peptide Based Entry Inhibitorsmentioning

confidence: 99%

Beyond the vaccines: a glance at the small molecule and peptide-based anti-COVID19 arsenal

Nepali

Sharma

et al. 2022

J Biomed Sci

View full text Add to dashboard Cite

Unprecedented efforts of the researchers have been witnessed in the recent past towards the development of vaccine platforms for the control of the COVID-19 pandemic. Albeit, vaccination stands as a practical strategy to prevent SARS-CoV-2 infection, supplementing the anti-COVID19 arsenal with therapeutic options such as small molecules/peptides and antibodies is being conceived as a prudent strategy to tackle the emerging SARS-CoV-2 variants. Noteworthy to mention that collective efforts from numerous teams have led to the generation of a voluminous library composed of chemically and mechanistically diverse small molecules as anti-COVID19 scaffolds. This review article presents an overview of medicinal chemistry campaigns and drug repurposing programs that culminated in the identification of a plethora of small molecule-based anti-COVID19 drugs mediating their antiviral effects through inhibition of proteases, S protein, RdRp, ACE2, TMPRSS2, cathepsin and other targets. In light of the evidence ascertaining the potential of small molecule drugs to approach conserved proteins required for the viral replication of all coronaviruses, accelerated FDA approvals are anticipated for small molecules for the treatment of COVID19 shortly. Though the recent attempts invested in this direction in pursuit of enrichment of the anti-COVID-19 armoury (chemical tools) are praiseworthy, some strategies need to be implemented to extract conclusive benefits of the recently reported small molecule viz. (i) detailed preclinical investigation of the generated anti-COVID19 scaffolds (ii) in-vitro profiling of the inhibitors against the emerging SARS-CoV-2 variants (iii) development of assays enabling rapid screening of the libraries of anti-COVID19 scaffold (iv) leveraging the applications of machine learning based predictive models to expedite the anti-COVID19 drug discovery campaign (v) design of antibody–drug conjugates.

show abstract

Section: Peptide Based Entry Inhibitorsmentioning

confidence: 99%

Beyond the vaccines: a glance at the small molecule and peptide-based anti-COVID19 arsenal

Nepali

Sharma

et al. 2022

J Biomed Sci

View full text Add to dashboard Cite

show abstract

“…Both of them exhibited influenza virus binding to the cells [80]. Six potential peptides recently reached preclinical trails: SBP1 (IEE-QAKTFLDKFNHEAEDLFYQS) [81], EK1C4 (SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG-PEG4-Chol) [82], P9R (NGAICWGPCPTAFRQIGNCGRFRVRCCRI) [83], QS1 (Ac-Abu-Tle-Leu-Gln-VS) [84], VIR251 (Ac-hTyr-Dap-Gly-Gly-VME) [85] and VIR250 (Ac-Abu(Bth)-Dap-Gly-Gly-VME) [85]. Multivalent peptides or nanomaterials might be a new avenue for the treatment of SARS-CoV-2, as suggested by Tabish et al [86].…”

Section: Antiviral Peptidesmentioning

confidence: 99%

Nanoscale Pathogens Treated with Nanomaterial-Like Peptides: A Platform Technology Appropriate for Future Pandemics

Nahhas

Webster

2021

Nanomedicine (Lond.)

View full text Add to dashboard Cite

Viral infections are historically very difficult to treat. Although imperfect and time-consuming to develop, we do have some conventional vaccine and therapeutic approaches to stop viral spreading. Most importantly, all of this takes significant time while viruses continue to wreak havoc on our healthcare system. Furthermore, viral infections are accompanied by a weakened immune system which is often overlooked in antiviral drug strategies and requires additional drug development. In this review, for the first time, we touch on some promising alternative approaches to treat viral infections, specifically those focused on the use of platform nanomaterials with antiviral peptides. In doing so, this review presents a timely discussion of how we need to change our old way of treating viruses into one that can quickly meet the demands of COVID-19, as well as future pandemic-causing viruses, which will come.

show abstract

“…Peptides 229E-HR1P and 229E-HR2P designed from HR1 and HR2 regions of human coronavirus (HCoV)-229E have demonstrated inhibitory activity against HCoV-229E spike protein ( Xia et al, 2018 ). Similarly, a defensin-like peptide P9R has exhibited pH dependent activity against respiratory viruses like SARS-CoV and MERS-CoV ( Zhao et al, 2020a ).…”

Section: Aquatic Avps Against Human and Animal Virusesmentioning

confidence: 99%

Antiviral peptides from aquatic organisms: Functionality and potential inhibitory effect on SARS-CoV-2

et al. 2021

View full text Add to dashboard Cite

Several antiviral peptides (AVPs) from aquatic organisms have been effective in interfering with the actions of infectious viruses, such as Human Immunodeficiency Virus-1 and Herpes Simplex Virus-1 and 2. AVPs are able to block viral attachment or entry into host cells, inhibit internal fusion or replication events by suppressing viral gene transcription, and prevent viral infections by modulating host immunity. Therefore, as promising therapeutics, the potential of aquatic AVPs for use against the COVID-19 pandemic caused by SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2) is considered. At present no therapeutic drugs are yet available. A total of 32 AVPs derived from fish and shellfish species are discussed in this review paper with notes on their properties and mechanisms of action in the inhibition of viral diseases both in humans and animals, emphasizing on SARS-CoV-2. The molecular structure of novel SARS-CoV-2 with its entry mechanisms, clinical signs and symptoms are also discussed. In spite of only a few study of these AVPs against SARS-CoV-2, aquatic AVPs properties and infection pathways (entry, replication and particle release) into coronaviruses are linked in this paper to postulate an analysis of their potential but unconfirmed actions to impair SARS-CoV-2 infection in humans.

show abstract

A broad-spectrum virus- and host-targeting antiviral peptide against SARS-CoV-2 and other respiratory viruses

Cited by 5 publications

References 48 publications

Beyond the vaccines: a glance at the small molecule and peptide-based anti-COVID19 arsenal

Beyond the vaccines: a glance at the small molecule and peptide-based anti-COVID19 arsenal

Nanoscale Pathogens Treated with Nanomaterial-Like Peptides: A Platform Technology Appropriate for Future Pandemics

Antiviral peptides from aquatic organisms: Functionality and potential inhibitory effect on SARS-CoV-2

Contact Info

Product

Resources

About