Identification and analysis of the tissue factor pathway inhibitor 2 of Sciaenops ocellatus

Zhang, Min; Xiao, Zhizhong; Sun, Li

doi:10.1016/j.fsi.2010.10.003

Cited by 5 publications

(3 citation statements)

References 38 publications

Supporting

Mentioning

Contrasting

Order By: Relevance

“…In addition, we found that high expression of PoTFPI-1 and PoTFPI-2 occurred in the liver, heart, blood, and intestines. High expression in the blood and heart were perhaps associated with the roles of TFPI-1 and TFPI-2 in blood coagulation mediated by a tissue factor pathway [22,37], which was similar to the results found in the red drum [35]. Increasing evidence indicates that teleost TFPI is involved in antimicrobial immunity, and its expression has been considered to be induced by infection.…”

Section: Discussionsupporting

confidence: 73%

Expression analysis of tissue factor pathway inhibitors TFPI-1 and TFPI-2 in Paralichthys olivaceus and antibacterial and anticancer activity of derived peptides

Wang

Xie

et al. 2021

Vet Res

Self Cite

View full text Add to dashboard Cite

Tissue factor pathway inhibitors (TFPI), including TFPI-1 and TFPI-2, are Kunitz-type serine protease inhibitors that mainly inhibit the blood coagulation induced by tissue factors. Previous reports on teleost proved TFPI play important roles in innate immunity. In this study, two TFPI (PoTFPI-1 and PoTFPI-2) molecules from Japanese flounder (Paralichthys olivaceus) were analyzed and characterized for their expression patterns, antibacterial and anticancer activities of the C-terminal derived peptides. Quantitative real time RT-PCR analysis shows that constitutive PoTFPI-1 expression occurred, in increasing order, in the brain, muscle, spleen, gills, head kidney, blood, intestine, heart, and liver; PoTFPI-2 was expressed, in increasing order, in the brain, gills, head kidney, muscle, intestine, spleen, liver, heart, and blood. Under the stimulation of fish pathogens, both PoTFPI-1 and PoTFPI-2 expressions increased significantly in a manner that depended on the pathogens, tissue type, and infection stage. Furthermore, C-terminal peptides TP25 and TP26, derived from PoTFPI-1 and PoTFPI-2, respectively, were synthesized and proved to be active against Micrococcus luteus (for TP25 and TP26) and Staphylococcus aureus (for TP25) via retardation effects on bacterial nucleic acids. In addition, TP25 and TP26 also displayed significant inhibitory effects on human colon cancer cell line HT-29. These results reveal that both PoTFPI-1 and PoTFPI-2 play important roles in host innate immunity. The antibacterial activity and anticancer cells function of TP25 and TP26 will add new insights into the roles of teleost TFPI.

show abstract

Section: Discussionsupporting

confidence: 73%

Expression analysis of tissue factor pathway inhibitors TFPI-1 and TFPI-2 in Paralichthys olivaceus and antibacterial and anticancer activity of derived peptides

Wang

Xie

et al. 2021

Vet Res

Self Cite

View full text Add to dashboard Cite

show abstract

“…Increasing studies have shown that teleosts TFPI-2 participated in antimicrobial immunity. Several studies had reported that bacterial or viral infection could induce TFPI-2 expression in different tissues [13,22,26]. Similarly, we also found that the expression of SsTFPI-2 was significantly induced by infection with L. anguillarum.…”

Section: Discussionsupporting

confidence: 81%

“…We examined the expression profiles of SsTFPI-2 in various tissues of black rockfish under normal physiological conditions, and the result showed that SsTFPI-2 expression was distributed in all the examined tissues, with it being highly expressed in the liver and spleen. The similar tissue distribution results were reported in red drum [26], tongue sole [13] and flounder [22]. The highest expression of TFPI-2 was also found in the liver in both red drum and flounder, which may be related to the role of TFPI-2 in tissue factor pathwaymediated coagulation [27].…”

Section: Discussionsupporting

confidence: 81%

Antimicrobial and Immunoregulatory Activities of TS40, a Derived Peptide of a TFPI-2 Homologue from Black Rockfish (Sebastes schlegelii)

Wang

Ding

et al. 2022

Marine Drugs

Self Cite

View full text Add to dashboard Cite

Tissue factor pathway inhibitor-2 (TFPI-2) is a Kunitz-type serine protease inhibitor. Previous reports have shown that TFPI-2 plays an important role in innate immunity, and the C-terminal region of TFPI-2 proved to be active against a broad-spectrum of microorganisms. In this study, the TFPI-2 homologue (SsTFPI-2) of black rockfish (Sebastods schegelii) was analyzed and characterized, and the biological functions of its C-terminal derived peptide TS40 (FVSRQSCMDVCAKGAKQHTSRGNVRRARRNRKNRITYLQA, corresponding to the amino acid sequence of 187-226) was investigated. The qRT-PCR (quantitative real-time reverse transcription-PCR) analysis showed that the expression of SsTFPI-2 was higher in the spleen and liver. The expression of SsTFPI-2 increased significantly under the stimulation of Listonella anguillarum. TS40 had a strong bactericidal effect on L. anguillarum and Staphylococcus aureus. Further studies found that TS40 can destroy the cell structure and enter the cytoplasm to interact with nucleic acids to exert its antibacterial activity. The in vivo study showed that TS40 treatment could significantly reduce the transmission of L. anguillarum and the viral evasion in fish. Finally, TS40 enhanced the respiratory burst ability, reactive oxygen species production and the expression of immune-related genes in macrophages, as well as promoted the proliferation of peripheral blood leukocytes. These results provide new insights into the role of teleost TFPI-2.

show abstract

Tissue factor pathway inhibitor-2 is critical in zebrafish cardiogenesis

Wang

Wen

Zhang

et al. 2015

Biochemical and Biophysical Research Communications

View full text Add to dashboard Cite

Identification and analysis of the tissue factor pathway inhibitor 2 of Sciaenops ocellatus

Cited by 5 publications

References 38 publications

Expression analysis of tissue factor pathway inhibitors TFPI-1 and TFPI-2 in Paralichthys olivaceus and antibacterial and anticancer activity of derived peptides

Expression analysis of tissue factor pathway inhibitors TFPI-1 and TFPI-2 in Paralichthys olivaceus and antibacterial and anticancer activity of derived peptides

Antimicrobial and Immunoregulatory Activities of TS40, a Derived Peptide of a TFPI-2 Homologue from Black Rockfish (Sebastes schlegelii)

Tissue factor pathway inhibitor-2 is critical in zebrafish cardiogenesis

Contact Info

Product

Resources

About