Expression and immunogenicity analysis of the capsid proteins of porcine circovirus types 2 to 4

Ji, Weilong; Zhang, Xinwei; Niu, Guyu; Chen, Si; Li, Xue; Yang, Lin; Zhang, Liying; Ren, Linzhu

doi:10.1016/j.ijbiomac.2022.07.204

Cited by 10 publications

(8 citation statements)

References 40 publications

Supporting

Mentioning

Contrasting

Order By: Relevance

“…The E. coli system is particularly advantageous for these purposes due to its ability to facilitate high-level expression, and the simplicity of purifying expressed proteins, making it an ideal choice for producing PCV4 capsid proteins and studying the effects of NLS truncation on VLP formation and Cap protein detection. Because the NLS at the N-terminus of Cap is rich in arginine residues, the expression of the Cap protein is often enhanced by truncating the NLS fragment in the E. coli system [ 34 , 35 ]. However, our study found that the truncation of NLS fragments affects the structural stability of VLPs.…”

Section: Discussionmentioning

confidence: 99%

See 1 more Smart Citation

The Nuclear Localization Signal of Porcine Circovirus Type 4 Affects the Subcellular Localization of the Virus Capsid and the Production of Virus-like Particles

Zheng,

Li,

et al. 2024

IJMS

Self Cite

View full text Add to dashboard Cite

Porcine circovirus 4 (PCV4) is a newly identified virus belonging to PCV of the Circoviridae family, the Circovirus genus. We previously found that PCV4 is pathogenic in vitro, while the virus’s replication in cells is still unknown. In this study, we evaluated the N-terminal of the PCV4 capsid (Cap) and identified an NLS at amino acid residues 4–37 of the N-terminus of the PCV4 Cap, 4RSRYSRRRRNRRNQRRRGLWPRASRRRYRWRRKN37. The NLS was further divided into two fragments (NLS-A and NLS-B) based on the predicted structure, including two α-helixes, which were located at 4RSRYSRRRRNRRNQRR19 and 24PRASRRRYRWRRK36, respectively. Further studies showed that the NLS, especially the first α-helixes formed by the NLS-A fragment, determined the nuclear localization of the Cap protein, and the amino acid 4RSRY7 in the NLS of the PCV4 Cap was the critical motif affecting the VLP packaging. These results will provide a theoretical basis for elucidating the infection mechanism of PCV4 and developing subunit vaccines based on VLPs.

show abstract

Section: Discussionmentioning

confidence: 99%

“…The obtained crude protein solution was filtered through a 0.45 μm filter and purified using a Ni-NTA purification resin pre-packed column (HisPur Ni-NTA, Thermo Scientific, Waltham, MA, USA) according to the protocol described previously in [ 34 ]. The protein was collected and evaluated by SDS-PAGE and Western blotting.…”

Section: Methodsmentioning

confidence: 99%

The Nuclear Localization Signal of Porcine Circovirus Type 4 Affects the Subcellular Localization of the Virus Capsid and the Production of Virus-like Particles

Zheng,

Li,

et al. 2024

IJMS

Self Cite

View full text Add to dashboard Cite

show abstract

“…It was reported that PCV2a or PCV2b-based vaccines could protect pigs against PCV2a, 2b, or even 2d infection [16][17][18]. We previously found that antisera prepared from the recombinant Caps of PCV2, PCV3, and PCV4 cross-reacted with different PCVs [41]. Furthermore, although PCV2 vaccines based on a single genotype may offer cross-protection, they may not provide enough coverage for the evolving field viruses [19,42].…”

Section: Discussionmentioning

confidence: 99%

Phylogenetic and Structural Analysis of Porcine Circovirus Type 2 from 2016 to 2021 in Jilin Province, China

Chen

Zhang

et al. 2023

Microorganisms

Self Cite

View full text Add to dashboard Cite

Porcine circovirus disease (PCVD) caused by porcine circovirus type 2 (PCV2) is widely distributed in pig farms. Up until now, nine genotypes of PCV2, PCV2a to 2i, have been identified in diseased pigs worldwide. This study analyzed 302 samples collected in the Jilin Province of China from 2016 to 2021, followed by genetic analysis of the PCV2 isolates. Meanwhile, the antigen epitopes, amino acid mutations, 3D structure of the PCV2 isolates and commercially available vaccine strains were evaluated and compared. The results showed that the predominant genotypes of PCV2 were PCV2b, followed by PCV2e and PCV2d in Jilin Province during 2016–2021. Although mutations were detected in the isolates, no recombination occurred in the PCV2 isolates, indicating a stable genotype of PCV2 in Jilin Province during these years. Moreover, the B cell epitopes in the Cap and Rep proteins of eighteen PCV2 isolates and T cell epitopes in the Cap of the isolates were changed compared to three currently used vaccine strains. The mutations in the Cap and Rep proteins did not affect their spatial conformation. Therefore, bivalent or multivalent vaccines with different genotypes of PCV2 might improve the protective effect of vaccines.

show abstract

“…The genome of PCVs encodes two major proteins, replicase (Rep) and capsid protein (Cap). Rep is involved in viral genomic replication, while Cap is the only structural protein of PCVs, and contains multiple antigen epitopes [ 48 ]. For example, a recombinant strain expressing the CAP protein of the PCV2 virus was constructed with Bacillus subtilis , and it showed that piglets with oral administration of Bacillus subtilis had induced a strong humoral immune response by increasing the levels of PCV2-specific immunoglobulin A (IgA) and IgG [ 49 ].…”

Section: Applications Of Probiotics In the Prevention And Treatment O...mentioning

confidence: 99%

Mechanisms and applications of probiotics in prevention and treatment of swine diseases

Zhang

Liu

et al. 2023

Porc Health Manag

View full text Add to dashboard Cite

Probiotics can improve animal health by regulating intestinal flora balance, improving the structure of the intestinal mucosa, and enhancing intestinal barrier function. At present, the use of probiotics has been a research hotspot in prevention and treatment of different diseases at home and abroad. This review has summarized the researchers and applications of probiotics in prevention and treatment of swine diseases, and elaborated the relevant mechanisms of probiotics, which aims to provide a reference for probiotics better applications to the prevention and treatment of swine diseases.

show abstract

Expression and immunogenicity analysis of the capsid proteins of porcine circovirus types 2 to 4

Cited by 10 publications

References 40 publications

The Nuclear Localization Signal of Porcine Circovirus Type 4 Affects the Subcellular Localization of the Virus Capsid and the Production of Virus-like Particles

The Nuclear Localization Signal of Porcine Circovirus Type 4 Affects the Subcellular Localization of the Virus Capsid and the Production of Virus-like Particles

Phylogenetic and Structural Analysis of Porcine Circovirus Type 2 from 2016 to 2021 in Jilin Province, China

Mechanisms and applications of probiotics in prevention and treatment of swine diseases

Contact Info

Product

Resources

About