MG53 protein rejuvenates hUC-MSCs and facilitates their therapeutic effects in AD mice by activating Nrf2 signaling pathway

Ma, Shanshan; Zhou, Xinrui; Wang, Yaping; Li, Zhe; Wang, Yingying; Shi, Jiandang; Guan, Fangxia

doi:10.1016/j.redox.2022.102325

Cited by 23 publications

(10 citation statements)

References 43 publications

Supporting

Mentioning

Contrasting

Order By: Relevance

“…In recent years, several studies had shown that myricetin had anti-oxidant, anti-bacterial, anti-inflammatory, immunomodulatory, and anti-cancer effects ( Alcaraz and Ferrandiz, 2020 ; Taheri et al, 2020 ). Myricetin can alleviate neuroinflammation caused by LPS ( Jang et al, 2020 ), reduce diabetic neuropathy ( Ma S et al, 2022 ), and improve learning and memory functions in Alzheimer’s disease ( Ramezani et al, 2016 ), indicating that it has neuroprotective effects. However, there is no report to demonstrate whether myricetin has the protective effects on HI-induced brain damage.…”

Section: Discussionmentioning

confidence: 99%

Myricetin attenuates hypoxic-ischemic brain damage in neonatal rats via NRF2 signaling pathway

Chen

Hu²,

Lu³

et al. 2023

Front. Pharmacol.

View full text Add to dashboard Cite

Introduction: Hypoxic-ischemic encephalopathy (HIE) is a crucial cause of neonatal death and neurological sequelae, but currently there is no effective therapy drug for HIE. Both oxidative stress and apoptosis play critical roles in the pathological development of HIE. Myricetin, a naturally extracted flavonol compound, exerts remarkable effects against oxidative stress, apoptosis, and inflammation. However, the role and underlying molecular mechanism of myricetin on HIE remain unclear.Methods: In this study, we established the neonatal rats hypoxic-ischemic (HI) brain damage model in vivo and CoCl2 induced PC12 cell model in vitro to explore the neuroprotective effects of myricetin on HI injury, and illuminate the potential mechanism.Results: Our results showed that myricetin intervention could significantly reduce brain infarction volume, glia activation, apoptosis, and oxidative stress marker levels through activating NRF2 (Nuclear factor-E2-related factor 2) and increase the expressions of NRF2 downstream proteins NQO-1 and HO-1. In addition, the NRF2 inhibitor ML385 could significantly reverse the effects of myricetin.Conclusion: This study found that myricetin might alleviate oxidative stress and apoptosis through NRF2 signaling pathway to exert the protective role for HI injury, which suggested that myricetin might be a promising therapeutic agent for HIE.

show abstract

Section: Discussionmentioning

confidence: 99%

Myricetin attenuates hypoxic-ischemic brain damage in neonatal rats via NRF2 signaling pathway

Chen

Hu²,

Lu³

et al. 2023

Front. Pharmacol.

View full text Add to dashboard Cite

show abstract

“…The total protein was separated by SDS-PAGE with 10% stacking gel and 12% separating gel at 80 V for 2 h and then transferred onto a PVDF membrane at 90 V for 55 min at 4 °C. Then, the membrane was blocked with 5% skimmed milk (diluted in TBS-T) at room temperature in a shaker for 1 h. After 3 washes with TBS-T, the membrane was incubated with the mouse GFP antibody [ 44 ] (1:4000, Proteintech Group, Wuhan, China), anti-GAPDH rabbit monoclonal antibody (1:30000, Boster, Wuhan, China) [ 45 ], or histone H3 antibody [ 46 ] (1:1000, Wanleibio, Shenyang, China) at room temperature for 2 h, followed by 3 washes with TBS-T. After that, the membrane was incubated with HRP-conjugated goat anti-mouse IgG(H+L) [ 47 ] (1:1000, Beyotime, Shanghai, China) or HRP-labeled goat anti-rabbit IgG(H+L) (1:1000, Beyotime, Shanghai, China) at room temperature for 1.5 h. Subsequently, the membrane was treated with ECL SuperSignal Solution [ 48 ] (Beyotime, Shanghai, China), and the protein bands were detected using a Bioanalytical Imaging System c600 (Azure Biosystems, Dublin, CA, USA).…”

Section: Methodsmentioning

confidence: 99%

The Nuclear Localization Signal of Porcine Circovirus Type 4 Affects the Subcellular Localization of the Virus Capsid and the Production of Virus-like Particles

Zheng,

Li,

et al. 2024

IJMS

View full text Add to dashboard Cite

Porcine circovirus 4 (PCV4) is a newly identified virus belonging to PCV of the Circoviridae family, the Circovirus genus. We previously found that PCV4 is pathogenic in vitro, while the virus’s replication in cells is still unknown. In this study, we evaluated the N-terminal of the PCV4 capsid (Cap) and identified an NLS at amino acid residues 4–37 of the N-terminus of the PCV4 Cap, 4RSRYSRRRRNRRNQRRRGLWPRASRRRYRWRRKN37. The NLS was further divided into two fragments (NLS-A and NLS-B) based on the predicted structure, including two α-helixes, which were located at 4RSRYSRRRRNRRNQRR19 and 24PRASRRRYRWRRK36, respectively. Further studies showed that the NLS, especially the first α-helixes formed by the NLS-A fragment, determined the nuclear localization of the Cap protein, and the amino acid 4RSRY7 in the NLS of the PCV4 Cap was the critical motif affecting the VLP packaging. These results will provide a theoretical basis for elucidating the infection mechanism of PCV4 and developing subunit vaccines based on VLPs.

show abstract

“…Additionally, in the background of NFE2L2 −/− , similar AD model mice showed significantly aggravated neuronal pathology and correlated memory deficits [ 128 , 129 ]. Various interventions improved the symptoms in AD model animals by activating NFE2L2 [ [130] , [131] , [132] , [133] , [134] , [135] ].…”

Section: Nfe2l2 Plays Distinct Roles In Neuronal Function As Wellmentioning

confidence: 99%

NFE2L1/Nrf1 serves as a potential therapeutical target for neurodegenerative diseases

Łuczyńska,

Zhang,

Pietras

et al. 2024

Redox Biology

View full text Add to dashboard Cite

MG53 protein rejuvenates hUC-MSCs and facilitates their therapeutic effects in AD mice by activating Nrf2 signaling pathway

Cited by 23 publications

References 43 publications

Myricetin attenuates hypoxic-ischemic brain damage in neonatal rats via NRF2 signaling pathway

Myricetin attenuates hypoxic-ischemic brain damage in neonatal rats via NRF2 signaling pathway

The Nuclear Localization Signal of Porcine Circovirus Type 4 Affects the Subcellular Localization of the Virus Capsid and the Production of Virus-like Particles

NFE2L1/Nrf1 serves as a potential therapeutical target for neurodegenerative diseases

Contact Info

Product

Resources

About