Navigating the signaling landscape of Ralstonia solanacearum: a study of bacterial two-component systems

Yadav, Mohit; Sathe, Janhavi; Teronpi, Valentina; Kumar, Aditya

doi:10.1007/s11274-024-03950-y

World J Microbiol Biotechnol

2024

DOI: 10.1007/s11274-024-03950-y

|View full text |Cite

Navigating the signaling landscape of Ralstonia solanacearum: a study of bacterial two-component systems

Mohit Yadav,

Janhavi Sathe,

Valentina Teronpi

et al.

Help me understand this report

Search citation statements

Order By: Relevance

Paper Sections

Select...

Citation Types

Supporting

Mentioning

Contrasting

Year Published

2024

2025

Publication Types

Select...

Article3

Relationship

Self Cite0

Independent3

Authors

Journals

Cited by 3 publications

References 92 publications

Supporting

Mentioning

Contrasting

Order By: Relevance

Exploring the multifaceted role of pehR in Ralstonia solanacearum pathogenesis: enzyme activity, motility, and biofilm formation

Sarkar,

Yadav,

Dey

et al. 2025

Microbiological Research

View full text Add to dashboard Cite

Exploring the multifaceted role of pehR in Ralstonia solanacearum pathogenesis: enzyme activity, motility, and biofilm formation

Sarkar,

Yadav,

Dey

et al. 2025

Microbiological Research

View full text Add to dashboard Cite

Decomposition solutions from brassica and cereal residues suppress tomato bacterial wilt disease by regulating rhizosphere microbial communities

Gao,

Fang,

Pan

et al. 2025

Microbiological Research

View full text Add to dashboard Cite

Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide

Tiwari,

Bhojiya,

Jain

et al. 2024

Front. Microbiol.

View full text Add to dashboard Cite

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from Lactiplantibacillus argentoratensis strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato (Solanum lycopersicum) caused by Ralstonia solanacearum. Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.3% and disease severity by 45.8%. Scanning electron microscopy revealed severe morphological disruptions in the bacterial cells upon exposure to the AMP. Additionally, the AMP enhanced host resistance by elevating defense enzyme activities, leading to notable improvements in plant morphology, including a 95.5% increase in plant length, a 20.1% increase in biomass, and a 96.69% increase in root length. This bifunctional AMP provides dual protection by exerting direct antimicrobial activity against the pathogen and eliciting plant defense mechanisms. These findings underscore the potential of this biologically sourced AMP as a natural agent for combating plant diseases and promoting growth in tomato crops. To the best of our knowledge, this is the first study to demonstrate the use of a foliar spray application of a biosynthesized microbial peptide as biocontrol agent against R. solanacearum. This interaction not only highlights its biocontrol efficacy but also its role in promoting the growth of Solanum lycopersicum thereby increasing overall agricultural yield.

show abstract

scite is a Brooklyn-based organization that helps researchers better discover and understand research articles through Smart Citations–citations that display the context of the citation and describe whether the article provides supporting or contrasting evidence. scite is used by students and researchers from around the world and is funded in part by the National Science Foundation and the National Institute on Drug Abuse of the National Institutes of Health.

Contact Info

customersupport@researchsolutions.com

10624 S. Eastern Ave., Ste. A-614

Henderson, NV 89052, USA

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Blog Terms and Conditions API Terms Privacy Policy Contact Cookie Preferences Do Not Sell or Share My Personal Information

Made with 💙 for researchers

Part of the Research Solutions Family.

Navigating the signaling landscape of Ralstonia solanacearum: a study of bacterial two-component systems

Cited by 3 publications

References 92 publications

Exploring the multifaceted role of pehR in Ralstonia solanacearum pathogenesis: enzyme activity, motility, and biofilm formation

Exploring the multifaceted role of pehR in Ralstonia solanacearum pathogenesis: enzyme activity, motility, and biofilm formation

Decomposition solutions from brassica and cereal residues suppress tomato bacterial wilt disease by regulating rhizosphere microbial communities

Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide

Contact Info

Product

Resources

About