No abstract

No abstract

A vacinação é uma das ações de saúde pública que tem colaborado com a diminuição da incidência das doenças imunopreveníveis. No entanto, as vacinas podem acarretar eventos adversos pós-vacinação. Assim, este estudo teve como objetivos: analisar a prevalência dos eventos adversos pós-vacinação em pessoas idosas; levantar os eventos notificados; identificar as vacinas que causaram eventos e verificar os eventos adversos pós-vacinação e as vacinas administradas que acarretaram internações no Estado de São Paulo, Brasil, nos anos de 2015 a 2017. Estudo descritivo, transversal, de abordagem quantitativa com base nas notificações de eventos adversos pós-vacinação registradas no Sistema de Informações do Programa Nacional de Imunizações. Os resultados mostraram que dentre as 15.196.080 pessoas idosas imunizadas, ocorreram 207 notificações de eventos adversos pós-vacinação, sendo 187 (89%) devido a evento adverso não grave e 15 (8%) por erro de imunização. A maioria dos acometidos era: do sexo feminino (86%); raça branca (49%); com idades de 60 a 69 anos (70%). Dentre as manifestações clínicas destacamos as reações nos locais das aplicações (84%). Constatou-se que 131 casos (64%) evoluíram para cura sem sequelas. Em relação às internações, verificou-se que duas pessoas (2%) foram hospitalizadas devido a efeito adverso grave, a primeira recebeu as vacinas: difteria/tétano adulto (dT), pneumocócica (Pn23) e influenza, e a segunda recebeu Pn23. Observaram-se informações incompletas nas notificações de eventos adversos pós-vacinação. Conclui-se que a notificação do eventos adversos pós-vacinação é essencial. Faz-se necessário o comprometimento dos profissionais no preenchimento adequado da notificação, e ainda, a supervisão da vigilância sanitária visando à qualidade da assistência prestada à pessoa idosa acometida por eventos adversos pós-vacinação.

ABSTRACT:Two presynaptic phospholipases A 2 (PLA 2 ), neuwieditoxin-I (NeuTX-I) and neuwieditoxin-II (NeuTX-II), were isolated from the venom of Bothrops neuwiedi pauloensis (BNP). The venom was fractionated using molecular exclusion HPLC (Protein-Pak 300SW column), followed by reverse phase HPLC (μBondapak C18 column). Tricine-SDS-PAGE in the presence or absence of dithiothreitol showed that NeuTX-I and NeuTX-II had a molecular mass of approximately 14 kDa and 28kDa, respectively. At 10μg/ml, both toxins produced complete neuromuscular blockade in indirectly stimulated chick biventer cervicis isolated preparation without inhibiting the response to acetylcholine, but NeuTX-II reduced the response to KCl by 67.0±8.0% (n=3; p<0.05). NeuTX-I and NeuTX-II are probably responsible for the presynaptic neurotoxicity of BNP venom in vitro. In fact, using loose patch clamp technique for mouse phrenic nerve-diaphragm preparation, NeuTX-I produced a calcium-dependent blockade of acetylcholine release and caused appearance of giant miniature end-plate potentials (mepps), indicating a pure presynaptic action. The N-terminal sequence of NeuTX-I was DLVQFGQMILKVAGRSLPKSYGAYGCYCGWGGRGK (71% homology with bothropstoxin-II and 54% homology with caudoxin) and that of NeuTX-II was SLFEFAKMILEETKRLPFPYYGAYGCYCGWGGQGQPKDAT (92% homology with Basp-III and 62% homology with crotoxin PLA2). The fact that NeuTX-I has Q-4 (Gln-4) and both toxins have F-5 (Phe-5) and Y-28 (Tyr-28) strongly suggests that NeuTX-I and NeuTX-II are Asp49 PLA 2 .

The neuromuscular effects of Bothrops neuwiedii pauloensis (jararaca-pintada) venom were studied on isolated chick biventer cervicis nerve-muscle preparations. Venom concentrations of 5-50 µg/ml produced an initial inhibition and a secondary increase of indirectly evoked twitches followed by a progressive concentration-dependent and irreversible neuromuscular blockade. At venom concentrations of 1-20 µg/ml, the responses to 13.4 mM KCl were inhibited whereas those to 110 µM acetylcholine alone and cumulative concentrations of 1 µM to 10 mM were unaffected. At venom concentrations higher than 50 µg/ml, there was pronounced muscle contracture with inhibition of the responses to acetylcholine, KCl and direct stimulation. At 20-24ºC, the venom (50 µg/ml) produced only partial neuromuscular blockade (30.7 ± 8.0%, N = 3) after 120 min and the initial inhibition and the secondary increase of the twitch responses caused by the venom were prolonged and pronounced and the response to KCl was unchanged. These results indicate that B.n. pauloensis venom is neurotoxic, acting primarily at presynaptic sites, and that enzyme activity may be involved in this pharmacological action.