A potential wound‐healing‐promoting peptide from salamander skin

Abstract

Although it is well known that wound healing proceeds incredibly quickly in urodele amphibians, such as newts and salamanders, little is known about skin-wound healing, and no bioactive/effector substance that contributes to wound healing has been identified from these animals. As a step toward understanding salamander wound healing and skin regeneration, a potential wound-healing-promoting peptide (tylotoin; KCVRQNNKRVCK) was identified from salamander skin of Tylototriton verrucosus. It shows comparable wound-healing-promoting ability (EC50=11.14 μg/ml) with epidermal growth factor (EGF; NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) in a murine model of full-thickness dermal wound. Tylotoin directly enhances the motility and proliferation of keratinocytes, vascular endothelial cells, and fibroblasts, resulting in accelerated reepithelialization and granulation tissue formation in the wound site. Tylotoin also promotes the release of transforming growth factor β1 (TGF-β1) and interleukin 6 (IL-6), which are essential in the wound healing response. Gene-encoded tylotoin secreted in salamander skin is possibly an effector molecule for skin wound healing. This study may facilitate understanding of the cellular and molecular events that underlie quick wound healing in salamanders.

Juglone ameliorates skin wound healing by promoting skin cell migration through Rac1/Cdc42/PAK pathway

“…Area stained blue in each image was considered as collagen and plotted as percent of total area in the form of graph. The percentage of reepithelialization was calculated as (distance covered by neoepithelium)/(distance between wound bed) × 100 ( n = 6) . Epidermal regeneration and granulation were assessed using a semi‐quantitative score system .…”

OM‐LV20, a novel peptide from odorous frog skin, accelerates wound healing in vitro and in vivo

“…Amphibian skin secretions are rich in bioactive peptides, with antimicrobial peptides, antioxidant peptides, lectins, and protease inhibitors formerly identified and characterized . Amphibian skin secretions also promote obvious wound healing; to date, however, only four related bioactive peptides have been identified . Odorous frog skins secrete diverse bioactive peptides, thus providing the potential for the discovery of new bioactive compounds .…”

“…[28,29] Amphibian skin secretions also promote obvious wound healing; to date, however, only four related bioactive peptides have been identified. [20][21][22][23] Odorous frog skins secrete diverse bioactive peptides, thus providing the potential for the discovery of new bioactive compounds. [24,[30][31][32] This research aimed to identify novel wound healing peptides from odorous frog skin secretions.…”

“…Their structural novelty and functional diversity suggest they can be developed into a wide variety of novel drugs . Research has shown that amphibian skins can heal rapidly without scarring, and thus it is reasonable to assume that certain molecules found within these secretions undertake this crucial wound healing responsibility; however, which molecules are involved remains unclear and, to date, only four wound healing peptides have been identified in amphibians . Thus, knowledge on amphibian skin wound healing peptides is limited and requires further research.…”

Prokineticin 2 Plays a Pivotal Role in Psoriasis

“…According to our previous method (Mu et al, 2014), after anesthetizing with 1% pentobarbital sodium (0.1 ml/20 g body weight), dorsal hairs were removed and dorsal skin was cleansed with betadine in male Kunming mice (age 6–8 week). Two full-thickness skin wounds were created on the back of each mouse using an 8-mm-diameter biopsy punch and each mouse was caged individually.…”