Detection of Ebola virus envelope using monoclonal and polyclonal antibodies in ELISA, surface plasmon resonance and a quartz crystal microbalance immunosensor

Yu, Jae Sung; Liao, Hua Xin; Gerdon, Aren E.; Huffman, Brian; Scearce, Richard M.; McAdams, Mille; Alam, Shabnam; Popernack, Paul M.; Sullivan, Nancy J.; Wright, David W.; Cliffel, David E.; Nabel, Gary J.; Haynes, Barton F.

doi:10.1016/j.jviromet.2006.06.014

Cited by 53 publications

(40 citation statements)

References 34 publications

Supporting

Mentioning

Contrasting

Unclassified

Order By: Relevance

“…Yu et al examined the antigenicity of these peptides. 8 They found that antibodies raised against the Cterminal peptide reacted with the native glycoproteins from both Ebola subtypes they studied (the Zaire and Sudan-Gulu subtypes). Antibodies raised against the N-terminal and mid-region peptides failed to react with the Ebola Zaire subtype.…”

Section: Resultsmentioning

confidence: 97%

“…8 Three principle regions were reported to have a high probability of possible antigenic activity: an Nterminal region, STDQLKSVGLNLEGSGVSTOIPSATKRWGFRSG (a.a. 59-91); a midpeptide region, DDDAASSRITKGRISDRATRKYSDLVPKNSPG (a.a. 318-349); and a Cterminal region, EPHDWTKNITDKINQIIHDFIDNPLPNQDNDD (a.a. 611-642). Yu et al examined the antigenicity of these peptides.…”

Section: Resultsmentioning

confidence: 99%

See 1 more Smart Citation

Design and synthesis of an antigenic mimic of the Ebola glycoprotein

et al. 2008

Self Cite

View full text Add to dashboard Cite

An antigenic mimic of the Ebola glycoprotein was synthesized and tested for its ability to be recognized by an anti-Ebola glycoprotein antibody. Epitope-mapping procedures yielded a suitable epitope that, when presented on the surface of a nanoparticle, forms a structure that is recognized by an antibody specific for the native protein. This mimic-antibody interaction has been quantitated through ELISA and QCM-based methods and yielded an affinity (K d = 12 × 10 −6 M) within two orders of magnitude of the reported affinity of the native Ebola glycoprotein for the same antibody. These results suggest that the rational design approach described herein is a suitable method for the further development of protein-based antigenic mimics with potential applications in vaccine development and sensor technology.

show abstract

Section: Resultsmentioning

confidence: 97%

Section: Resultsmentioning

confidence: 99%

Design and synthesis of an antigenic mimic of the Ebola glycoprotein

et al. 2008

Self Cite

View full text Add to dashboard Cite

show abstract

“…This approach was extended to highly virulent species like Ebola virus (EBOV). Yu et al [99] raised both polyclonal and monoclonal antibodies in rabbits against soluble EBOV envelope glycoprotein (GP) to study EBOV envelope diversity and develop diagnostics. Three regions were used for the generation of anti-EBOV polyclonal antibodies, namely: Sudan-Gulu, Zaire, and Ivory Coast, EBOV GP peptides to immunize rabbits.…”

Section: Natural Antibodies For Qcm Virus Sensorsmentioning

confidence: 99%

“…regions were used for the generation of anti-EBOV polyclonal antibodies, namely: Sudan-Gulu, Zaire, and Ivory Coast, EBOV GP peptides to immunize rabbits. To record sensor responses, a freshly prepared sensor was exposed to each species of EBOV GP and the binding events were monitored in real-time for 12 min [99]. In this study, the QCM device could measure low concentration of EBOV GP with the lowest detection limits of 14 nM and 56 nM for the Zaire and Sudan-Gulu EBOV GPs, respectively.…”

Section: Natural Antibodies For Qcm Virus Sensorsmentioning

confidence: 99%

Gravimetric Viral Diagnostics: QCM Based Biosensors for Early Detection of Viruses

et al. 2017

View full text Add to dashboard Cite

Viruses are pathogenic microorganisms that can inhabit and replicate in human bodies causing a number of widespread infectious diseases such as influenza, gastroenteritis, hepatitis, meningitis, pneumonia, acquired immune deficiency syndrome (AIDS) etc. A majority of these viral diseases are contagious and can spread from infected to healthy human beings. The most important step in the treatment of these contagious diseases and to prevent their unwanted spread is to timely detect the disease-causing viruses. Gravimetric viral diagnostics based on quartz crystal microbalance (QCM) transducers and natural or synthetic receptors are miniaturized sensing platforms that can selectively recognize and quantify harmful virus species. Herein, a review of the label-free QCM virus sensors for clinical diagnostics and point of care (POC) applications is presented with major emphasis on the nature and performance of different receptors ranging from the natural or synthetic antibodies to selective macromolecular materials such as DNA and aptamers. A performance comparison of different receptors is provided and their limitations are discussed.

show abstract

“…To date, QCM immunosensors have been developed to detect pathogenic microorganisms such as Francisella tularensis [9], Vibrio cholerae [10], Ebola virus [11], and Influenza virus [12]. However, to the best of our knowledge, there are only two articles related to B. anthracis spore detection via QCM immunosensor in the literature.…”

Section: Introductionmentioning

confidence: 99%

Simultaneous Bacillus anthracis Spores Detection via Aminated-Poly(vinyl chloride) Coated Piezoelectric Crystal Immunosensor

Oztuna

Nazır

Baysallar

2014

Journal of Coatings

View full text Add to dashboard Cite

Bacillus anthracis spores are a potential threat to countries in the context of biodefense. We have already seen the destructiveness of the anthrax attacks in the recent past. This study presents an aminated-poly(vinyl chloride) (PVC-NH 2 ) coated quartz crystal microbalance (QCM) immunosensor for simultaneous rapid detection of B. anthracis spores. PVC-NH 2 , synthesized in the laboratory, was used as an adhesive layer for monoclonal antibody immobilization on gold quartz crystal. The prepared QCM sensor was tested using a pathogen field strain of B. anthracis (GenBank number: GQ375871.1) under static addition and flow through procedures with different spore concentrations. Fourier transform infrared spectroscopy (FTIR-ATR) and scanning electron microscopy (SEM) were performed to characterize the surface of the sensor during the modification. Furthermore, a series of SEM micrographs were taken in order to investigate surface morphology and show the presence of the B. anthracis spores on the surface. It is concluded that B. anthracis spores can be accomplished by using amine functionalized polymer coated QCM sensors without requiring complicated immobilization procedures or expensive preliminary preparations.

show abstract

Detection of Ebola virus envelope using monoclonal and polyclonal antibodies in ELISA, surface plasmon resonance and a quartz crystal microbalance immunosensor

Cited by 53 publications

References 34 publications

Design and synthesis of an antigenic mimic of the Ebola glycoprotein

Design and synthesis of an antigenic mimic of the Ebola glycoprotein

Gravimetric Viral Diagnostics: QCM Based Biosensors for Early Detection of Viruses

Simultaneous Bacillus anthracis Spores Detection via Aminated-Poly(vinyl chloride) Coated Piezoelectric Crystal Immunosensor

Contact Info

Product

Resources

About