Pepscan Mapping of Viral Hemorrhagic Septicemia Virus Glycoprotein G Major Lineal Determinants Implicated in Triggering Host Cell Antiviral Responses Mediated by Type I Interferon

Attenuated Infectious Hematopoietic Necrosis Virus with Rearranged Gene Order as Potential Vaccine

“…Therefore, we also studied the potential of each of these viruses to induce the transcription of a selection of genes implicated in the type I IFN response in rainbow trout cells. We observed that the capacity of these rIHNVs to induce the transcription of genes related to this IFN response was not affected by the position of the G gene in the genome, as would had been expected based on the fact that the G gene is a strong inducer of type I IFN (25,27). Instead, N2G3, N2G4, and N3G4, in which the N transcription levels were reduced, were clearly much stronger inducers of type I IFN.…”

Protection and antibody response induced by intramuscular DNA vaccine encoding for viral haemorrhagic septicaemia virus (VHSV) G glycoprotein in turbot (Scophthalmus maximus)

“…The presence of specific antibodies against gpG in turbot sera was determined at day 30 post-vaccination through enzyme-linked immunosorbent assay (ELISA) using a synthetic peptide (aa 280e310) from the gpG of the VHSV 07.71 [30], previously named peptide 31 LTPNKCVNTDIQMRGATDDFSYLNHLITNMA, as antigen [34]. There are only 2 amino acid differences between the VHSV strains (underlined N283K and D298E, single letter aminoacid in 07.71 position amino acid in 860 strain, respectively).…”

VHSV G glycoprotein major determinants implicated in triggering the host type I IFN antiviral response as DNA vaccine molecular adjuvants

“…We recently identified two linear determinants of gpG VHSV (peptides p31 and p33) implicated in triggering a cell antiviral response mediated by type I IFN [21]. Moreover, we demonstrated that these short viral glycoprotein segments were able to protect cells against VHSV infection.…”

“…Three days after transfection, cells were fixed with cold methanol and incubated with the rabbit anti-trout Mx3 polyclonal serum [21] diluted 200-fold in PBS at room temperature for 2 h. The indirect staining was carried out using a goat anti-rabbit antibody conjugated with rhodamine (Sigma). Stained cells were viewed and photographed with an inverted fluorescence microscope provided with a digital camera (Nikon DS-1QM).…”

“…Likewise, previously published protocols were followed for quantitative PCR (qPCR) [21]. Primers and probes are listed in Table S1.…”