Recent Updates on Marine Cancer-Preventive Compounds

Abstract

The natural compounds derived from marine organisms often exhibit unique chemical structures and potent biological activities. Cancer-preventive activity is one of the rather new activities that has emerged and been extensively studied over the last decades. This review summarizes the recent updates on the marine chemopreventive compounds covering the relevant literature published in 2013–2021 and following the previous comprehensive review by Stonik and Fedorov (Marine Drugs 2014, 12, 636–671). In the current article, only the molecules having an effect on malignant transformation (or related pathway and molecules), cancer stem cells, or carcinogen-induced in vivo tumor development were considered to be “true” cancer-preventive compounds and were, therefore, reviewed. Additionally, particular attention has been given to the molecular mechanisms of chemoprevention, executed by the reported marine compounds.

Natural Products of Marine Origin for the Treatment of Colorectal and Pancreatic Cancers: Mechanisms and Potential

“…MNPs compounds have different activities including the inhibition of the transformation of normal cells into tumor cells, halting tumor cell growth and microtumors development, and inducing apoptosis. A higher consumption of sea food is suggested as a promising strategy to prevent cancer [ 106 , 107 ]. Many marine edible organisms contain lipids enriched by polyunsaturated fatty acids (PUFAs), such as ω-3 fatty acids that have been shown in many experimental studies to suppress most forms of tumor development, including breast, colon, prostate, liver, and pancreatic tumors [ 41 , 108 , 109 ].…”

Marine Bioactive Compounds as Nutraceutical and Functional Food Ingredients for Potential Oral Health

“…rigida , exhibit potent in vitro cytotoxic activity ( 110 ). Pardaxin (H- GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE-OH) is a 33 amino acid peptide, an antimicrobial peptide (AMP) isolated from marine fish species Pardachirus marmoratus ( 111 – 113 ). It is also a possible marine bioactive component for adjuvant chemotherapy in human OSCC care.…”

5-epi-Sinuleptolide from Soft Corals of the Genus Sinularia Exerts Cytotoxic Effects on Pancreatic Cancer Cell Lines via the Inhibition of JAK2/STAT3, AKT, and ERK Activity

“…The lack of effective anti-pancreatic cancer drugs prompted us to investigate bioactive compounds as alternative options for treating pancreatic cancer, especially natural products. The marine environment represents an exceptional reservoir comprising an enormous source of novel and biologically active compounds that are amenable to drug discovery [8]. Many marine natural products have been shown to possess significant pharmacological activities, in particular anticancer [9,10], anti-inflammatory [8], and antimicrobial properties [11], revealing the potential for the discovery and development of new medicines from marine environment.…”

“…The marine environment represents an exceptional reservoir comprising an enormous source of novel and biologically active compounds that are amenable to drug discovery [8]. Many marine natural products have been shown to possess significant pharmacological activities, in particular anticancer [9,10], anti-inflammatory [8], and antimicrobial properties [11], revealing the potential for the discovery and development of new medicines from marine environment. The soft corals of Sinularia genus are marine organisms well recognized for their capability to generate bioactive and structurally versatile natural products, among which two diastereomeric norcembranoids-sinuleptolide and 5-epi-sinuleptolide (Figure 1)-have been isolated from the soft corals Sinularia leptoclados [12] and S. scabra [13].…”