BackgroundThe giant panda (Ailuropoda melanoleuca) is a vulnerable mammal herbivore living wild in central China. Viral infections have become a potential threat to the health of these endangered animals, but limited information related to these infections is available.MethodsUsing a viral metagenomic approach, we surveyed viruses in the feces, nasopharyngeal secretions, blood, and different tissues from a wild giant panda that died from an unknown disease, a healthy wild giant panda, and 46 healthy captive animals.ResultsThe previously uncharacterized complete or near complete genomes of four viruses from three genera in Papillomaviridae family, six viruses in a proposed new Picornaviridae genus (Aimelvirus), two unclassified viruses related to posaviruses in Picornavirales order, 19 anelloviruses in four different clades of Anelloviridae family, four putative circoviruses, and 15 viruses belonging to the recently described Genomoviridae family were sequenced. Reflecting the diet of giant pandas, numerous insect virus sequences related to the families Iflaviridae, Dicistroviridae, Iridoviridae, Baculoviridae, Polydnaviridae, and subfamily Densovirinae and plant viruses sequences related to the families Tombusviridae, Partitiviridae, Secoviridae, Geminiviridae, Luteoviridae, Virgaviridae, and Rhabdoviridae; genus Umbravirus, Alphaflexiviridae, and Phycodnaviridae were also detected in fecal samples. A small number of insect virus sequences were also detected in the nasopharyngeal secretions of healthy giant pandas and lung tissues from the dead wild giant panda. Although the viral families present in the sick giant panda were also detected in the healthy ones, a higher proportion of papillomaviruses, picornaviruses, and anelloviruses reads were detected in the diseased panda.ConclusionThis viral survey increases our understanding of eukaryotic viruses in giant pandas and provides a baseline for comparison to viruses detected in future infectious disease outbreaks. The similar viral families detected in sick and healthy giant pandas indicate that these viruses result in commensal infections in most immuno-competent animals.Electronic supplementary materialThe online version of this article (doi:10.1186/s40168-017-0308-0) contains supplementary material, which is available to authorized users.

Abstract. Knowledge of aerosol chemistry in densely populated regions is critical for effective reduction of air pollution, while such studies have not been conducted in Changzhou, an important manufacturing base and populated city in the Yangtze River Delta (YRD), China. This work, for the first time, performed a thorough chemical characterization on the fine particulate matter (PM 2.5 ) samples, collected during July 2015 to April 2016 across four seasons in this city. A suite of analytical techniques was employed to measure the organic carbon (OC), elemental carbon (EC), watersoluble organic carbon (WSOC), water-soluble inorganic ions (WSIIs), trace elements, and polycyclic aromatic hydrocarbons (PAHs) in PM 2.5 ; in particular, an Aerodyne soot particle aerosol mass spectrometer (SP-AMS) was deployed to probe the chemical properties of water-soluble organic aerosol (WSOA). The average PM 2.5 concentration was found to be 108.3 µg m −3 , and all identified species were able to reconstruct ∼ 80 % of the PM 2.5 mass. The WSIIs occupied about half of the PM 2.5 mass (∼ 52.1 %), with SO 2− 4 , NO − 3 , and NH + 4 as the major ions. On average, nitrate concentrations dominated over sulfate (mass ratio of 1.21), indicating that traffic emissions were more important than stationary sources. OC and EC correlated well with each other and the highest OC / EC ratio (5.16) occurred in winter, suggesting complex OC sources likely including both secondary and primary ones. Concentrations of eight trace elements (Mn, Zn, Al, B, Cr, Cu, Fe, Pb) can contribute up to ∼ 5.0 % of PM 2.5 during winter. PAH concentrations were also high in winter (140.25 ng m −3 ), which were predominated by median/high molecular weight PAHs with five and six rings. The organic matter including both watersoluble and water-insoluble species occupied ∼ 21.5 % of the PM 2.5 mass. SP-AMS determined that the WSOA had average atomic oxygen-to-carbon (O / C), hydrogen-to-carbon (H / C), nitrogen-to-carbon (N / C), and organic matter-toorganic carbon (OM / OC) ratios of 0.54, 1.69, 0.11, and 1.99, respectively. Source apportionment of WSOA further identified two secondary OA (SOA) factors (a less oxidized and a more oxidized oxygenated OA) and two primary OA (POA) factors (a nitrogen-enriched hydrocarbon-like traffic OA and a local primary OA likely including species from cooking, coal combustion, etc.). On average, the POA contribution outweighed SOA (55 % vs. 45 %), indicating the important role of local anthropogenic emissions in the aerosol pollution in Changzhou. Our measurement also shows the abundance of organic nitrogen species in WSOA, and the source analyses suggest these species are likely associated with traffic emissions, which warrants more investigations on PM samples from other locations.

No abstract

No abstract

A novel defensin-like antimicrobial peptide named longicornsin was isolated from the salivary glands of the hard tick, Haemaphysalis longicornis, using a 10-kDa cut-off Centriprep filter and reversed-phase high-performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined as DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVG by Edman degradation. The cDNA encoding longicornsin was cloned by cDNA library screening. The predicted protein from the cDNA sequence was composed of 78 amino acids including a mature longicornsin. It showed similarity with defensin-like peptides from other ticks by BLAST search. Different from most other tick defensin-like peptides, longicornsin had a C-terminal extension. Purified longicornsin exerted potent antimicrobial activities against bacteria and fungi. Interestingly, it even showed strong antimicrobial ability against drug-resistant microorganisms and Helicobacter pylori. The results of this study indicated that longicornsin is a potential candidate for novel antimicrobial drug design.