Lipidation increases antiviral activities of coronavirus fusion-inhibiting peptides

Park, Jung Eun; Gallagher, Tom

doi:10.1016/j.virol.2017.07.033

Cited by 23 publications

(21 citation statements)

References 88 publications

Supporting

Mentioning

Contrasting

Order By: Relevance

“…Furthermore, since CoV receptors and proteases tend to partition in lipid-enriched domains, another group tested the possibility of directing HR2 peptides towards these lipid-enriched domains where CoV entry occurs. Conjugating palmitate, which partitions into lipid rafts, to HR2P-M2 was found to increase inhibition of SARSpp and MERSpp cell entry (Park and Gallagher, 2017). On the other hand, conjugating tocopherol, which partitions into non-raft domains, to HR2P-M2 had minimal impact on cell entry.…”

Section: Sars-cov and Mers-cov Current Antifusogenicsmentioning

confidence: 91%

Coronavirus membrane fusion mechanism offers a potential target for antiviral development

et al. 2020

View full text Add to dashboard Cite

The coronavirus disease 2019 (COVID-19) pandemic has focused attention on the need to develop effective therapies against the causative agent, SARS-CoV-2, and also against other pathogenic coronaviruses (CoV) that have emerged in the past or might appear in future. Researchers are therefore focusing on steps in the CoV replication cycle that may be vulnerable to inhibition by broad-spectrum or specific antiviral agents. The conserved nature of the fusion domain and mechanism across the CoV family make it a valuable target to elucidate and develop pan-CoV therapeutics. In this article, we review the role of the CoV spike protein in mediating fusion of the viral and host cell membranes, summarizing the results of research on SARS-CoV, MERS-CoV, and recent peer-reviewed studies of SARS-CoV-2, and suggest that the fusion mechanism be investigated as a potential antiviral target. We also provide a supplemental file containing background information on the biology, epidemiology, and clinical features of all human-infecting coronaviruses, along with a phylogenetic tree of these coronaviruses.

show abstract

Section: Sars-cov and Mers-cov Current Antifusogenicsmentioning

confidence: 91%

Coronavirus membrane fusion mechanism offers a potential target for antiviral development

et al. 2020

View full text Add to dashboard Cite

show abstract

“…Besides, the S2 domain of the SARS-CoV S protein contains heptad repeat HR1 and HR2 sequences. Peptide HR2 (HR2: SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL) and its lipid-binding peptide is highly similar or even identical to the near-membrane portion of S protein ferredoxin, which interferes with refolding into post-fusion fusion-catalyzing domains (FDs) ( Du et al, 2009 ; Park and Gallagher, 2017 ). According to recent research, the lipopeptide EK1C4, derived from EK1 (SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL), is the most effective fusion inhibitor against COVID-19 S protein-mediated membrane fusion ( Xia et al, 2020 ).…”

Section: Classification Of Ampsmentioning

confidence: 99%

Antimicrobial Peptides: Classification, Design, Application and Research Progress in Multiple Fields

et al. 2020

View full text Add to dashboard Cite

Antimicrobial peptides (AMPs) are a class of small peptides that widely exist in nature and they are an important part of the innate immune system of different organisms. AMPs have a wide range of inhibitory effects against bacteria, fungi, parasites and viruses. The emergence of antibiotic-resistant microorganisms and the increasing of concerns about the use of antibiotics resulted in the development of AMPs, which have a good application prospect in medicine, food, animal husbandry, agriculture and aquaculture. This review introduces the progress of research on AMPs comprehensively and systematically, including their classification, mechanism of action, design methods, environmental factors affecting their activity, application status, prospects in various fields and problems to be solved. The research progress on antivirus peptides, especially anti-coronavirus (COVID-19) peptides, has been introduced given the COVID-19 pandemic worldwide in 2020.

show abstract

“…Dectin-1 is a specific receptor for β-glucan, expressed on phagocytes and immunocompetent cells. The investigation of Park and Gallagher (2017) , showed a decrease in the influenza virus replication due to an increase in the interferon-gamma and nitric oxide production. β-glucan is associated with immune-modulatory action like the production of nitric oxide (potent viral replication inhibitor), reactive oxygen species, and release of cytokines ( Reboul, 2017 ).…”

Section: Nutrients Possessing Antiviral Propertiesmentioning

confidence: 99%

Role of food nutrients and supplementation in fighting against viral infections and boosting immunity: A review

Thirumdas

Kothakota

Pandiselvam

et al. 2021

Trends in Food Science & Technology

View full text Add to dashboard Cite

Background The viral infections can be highly contagious and easily transmissible, which even can lead to a pandemic, like the recent COVID-19 outbreak, causing massive deaths worldwide. While, still the best practical way to prevent the transmission of viruses is to practice self-sanitation and follow social distancing principles, enhancing the individual's immunity through the consumption of proper foods containing balanced nutrients can have significant result against viral infections. Foods containing nutrients such as vitamins, minerals, fatty acids, few polysaccharides, and some non-nutrients (i.e. polyphenols) have shown therapeutic potential against the function of viruses and can increase the immunity of people. Scope and approach The results of conducted works aiming for studying the potential antiviral characteristics of diverse groups of foods and food's nutrients (in terms of polysaccharides, proteins, lipids, vitamins, and minerals) are critically discussed. Key findings and conclusion Nutrients, besides playing an important role in maintaining normal physiology of human's body and healthiness, are also required for enhancing the immunity of the body and can be effective against viral infections. They can present antiviral capacity either by entering into the defensive mechanism directly through interfering with the target viruses, or indirectly through activating the cells associated with the adaptive immune system. During the current situation of COVID-19 pandemic (the lack of proper curative viral drug), enhancing the immunity of individual's body through proposing the appropriate diet (rich in both macro and micro-nutrients) is one of few practical preventive measures available in fighting against Coronaviruses, this significant health-threatening virus, as well as other viruses in general.

show abstract

Lipidation increases antiviral activities of coronavirus fusion-inhibiting peptides

Cited by 23 publications

References 88 publications

Coronavirus membrane fusion mechanism offers a potential target for antiviral development

Coronavirus membrane fusion mechanism offers a potential target for antiviral development

Antimicrobial Peptides: Classification, Design, Application and Research Progress in Multiple Fields

Role of food nutrients and supplementation in fighting against viral infections and boosting immunity: A review

Contact Info

Product

Resources

About